PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn343391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 1071aa    MW: 118321 Da    PI: 8.0582
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn343391genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.93.8e-40145222178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +Cqv+ C++dls+ak+yhrrhkvCevhsk++++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Achn343391 145 MCQVDTCREDLSNAKDYHRRHKVCEVHSKSSNALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQT 222
                 6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-33140207IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.667143220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-37144223IPR004333Transcription factor, SBP-box
PfamPF031104.3E-29146219IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1071 aa     Download sequence    Send to blast
MEEVGAQVAP PMFMHKNLGG RFHEGHSMTK KRGLPNFHHQ QPRLTAGYGW NTNGWDWDSV  60
RFVAKPLESD VLCLGTARSV QSEQRRTSDG EGSGVPTSLE KKSVVEDDES LRLKLGGSLN  120
SSEEPVSKPN KRVRSGSPGG GSYPMCQVDT CREDLSNAKD YHRRHKVCEV HSKSSNALVG  180
KQMQRFCQQC SRFHPLSEFD EGKRSCRRRL AGHNRRRRKT QTEDVSSRIL LSGNHNNTHN  240
GDLDIVNLLT VLAQTQGHKE VKSTNCSTLP NKDHLIQILS KIKPLPVDIE AKLPAPGSLS  300
KPVPEQASSD NQNRLNANVS SSSTKDLLAV LSATLASPSP NALAILSQRS SQGIDADDTK  360
LACLNQALSL NMQNGAALQF PSVGGARSST SYQSPVEDSD CQVQETRTNL PLQLFSSSPE  420
YDSPPKLACA RKYFSSDSSN AIEDSSPSSS PPVAQKLFPM QTTRETEPKR ISTSRKNAYV  480
ETSKAHGCVT SLELFGLSNR GADNSSFQSL PYQAGYTSSS GSDHSPSSLN SDAQDRTGRM  540
IFKLFGKNPS QLPETLRTQI NNWLSHSPSE MESYIRPGCV ILSIYLSMPY SAWEQLEANL  600
LRHVNSLVRD SDTDFWRNGR FLLQIGRQLA SHKDGEFRLC KSWRAWHSPE LISVSPLAVV  660
GGEETSLFLR GRNLNIPGTK IHWTHMGGYL SEEVPGSASQ ETVYDEISLV SFKIHGVAPG  720
VLGRCFIEVE NGFKGTTFPV IIADATICKE LRLLESAFGE GAKVQDTISE EQIPDFGQPW  780
SKDEVLHFLN ELGWLFQRKR NSSTCDTPNY TLARFKFLFV FSVERNCCAL VKTLLDILLE  840
LDLHRGEPSK ESLDMLSEIH LLNRAVKRRC KNMVDLLIHY PVPSGDSTLK HIFPPNLVGP  900
GGVTPLHLAA CTSSSDDVVD ALTGDPQEIG LHCWNSLLDA NWLSPYAYAL MRNNHSYNSL  960
VARKLADRKN GQVCVSVATE IETQWSGVSQ DHHPRPLIKQ AQRSCSKCAV VASRYNRMMP  1020
VSQGFLHRSY MLSMLAVAAV CVCVCLFLRG HPDVGLVAPF RWENLSYGPS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31136219184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1863868RAVKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273784.10.0PREDICTED: squamosa promoter-binding-like protein 14 isoform X2
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLF6I6X10.0F6I6X1_VITVI; Putative uncharacterized protein
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128871219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14